PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0179s0060.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 218aa    MW: 23347 Da    PI: 6.9483
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0179s0060.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.73.4e-302779254
              G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                         pr+rWt eLH++F  av++LGG+e+AtPk i++lm+vkgLt++hvkSHLQ+YR
  Kalax.0179s0060.1.p 27 PRMRWTRELHDAFELAVHRLGGEERATPKMIMQLMDVKGLTISHVKSHLQMYR 79
                         9**************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-282380IPR009057Homeodomain-like
SuperFamilySSF466896.09E-152679IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-222779IPR006447Myb domain, plants
PfamPF002491.2E-72879IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MDMQQGSGGA GGSNGLAVRP YVRSAAPRMR WTRELHDAFE LAVHRLGGEE RATPKMIMQL  60
MDVKGLTISH VKSHLQMYRG VKHERMIRDA LRSGREIRRR HHALDYKDFF SYGSGAGCEP  120
GAGCWSEEKG KKGSGVTSEE CLSESNQTAE WGGPKQTGSY IVFKDLFPGP ASMHQESEVG  180
SRQEECSTEN ASAGSGPPST SGGGAGDGDV SLELTLG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.12e-28G2-like family protein